PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_015122-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 265aa    MW: 30176.6 Da    PI: 5.2342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_015122-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.1e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l  +++++G  +W+  +r  g+ R++k+c++rw +yl
    NNU_015122-RA 16 KGAWTPEEDEKLTAYIRRYGHWNWRELPRFAGLSRCGKSCRLRWVNYL 63
                     79******************99************************97 PP

2Myb_DNA-binding569.4e-1869114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eEde+++++++ lG++ W++I++ ++ gRt++++k++w+++l
    NNU_015122-RA  69 RGNFSAEEDEIIINLHQSLGNK-WAAISAQLP-GRTDNEVKNYWHSHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0781163IPR017930Myb domain
SuperFamilySSF466891.61E-3014110IPR009057Homeodomain-like
SMARTSM007171.7E-121565IPR001005SANT/Myb domain
PfamPF002491.4E-131663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-231770IPR009057Homeodomain-like
CDDcd001677.07E-101863No hitNo description
PROSITE profilePS5129426.0264118IPR017930Myb domain
SMARTSM007171.8E-1668116IPR001005SANT/Myb domain
PfamPF002495.6E-1669114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2771119IPR009057Homeodomain-like
CDDcd001672.56E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MVMKSADSQQ KTELKKGAWT PEEDEKLTAY IRRYGHWNWR ELPRFAGLSR CGKSCRLRWV  60
NYLRPGIKRG NFSAEEDEII INLHQSLGNK WAAISAQLPG RTDNEVKNYW HSHLKKRLKQ  120
DPTASTKEKL QSEEISDYSK AETNDNFKKE SEPETSPSIP GILSDEVERF QLSSPEYCSS  180
DLYYSPSTDS GVIVGTDKHK TTLPQSSASF WTEPYLAGNA YINDDFLEAF ANLESLSPFS  240
LVSLGEPLYQ SGFFIDDYMN ISSTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271311824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113119LKKRLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268949.10.0PREDICTED: myb-related protein 308-like
TrEMBLB9INU36e-69B9INU3_POPTR; Uncharacterized protein
STRINGPOPTR_0019s14140.12e-68(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-57myb domain protein 14